PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000499023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 349aa    MW: 39496.5 Da    PI: 9.6503
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000499023genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.33.7e-50151421128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhP+deel+v+yL++k+ +++l++ + i+e+d+yk++Pw+Lp+k+  +e ewyfFs+rd+ky++g+r+nr+++ gyWka g+dk++l++ 
  MDP0000499023  15 LPPGFRFHPSDEELIVHYLRNKMISHPLPA-QLITEIDLYKYNPWELPNKALFGEXEWYFFSPRDRKYPNGERPNRTAALGYWKAAGSDKPILTSc 109
                    79****************************.89***************88888999*************************************998 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++ +g+kk Lvfy+grapkg+kt+W+m+eyrl
  MDP0000499023 110 GSKRIGVKKALVFYTGRAPKGVKTEWIMNEYRL 142
                    8889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-619169IPR003441NAC domain
PROSITE profilePS5100558.68415170IPR003441NAC domain
PfamPF023652.0E-2516142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MEKEPTFTTY STMQLPPGFR FHPSDEELIV HYLRNKMISH PLPAQLITEI DLYKYNPWEL  60
PNKALFGEXE WYFFSPRDRK YPNGERPNRT AALGYWKAAG SDKPILTSCG SKRIGVKKAL  120
VFYTGRAPKG VKTEWIMNEY RLLDXTVNPS RSKGSMRQLD DWVLCRVQQR GNTTKNXCNA  180
QDIYNTEFWR CLPKSGPTVR PTSPIHRADI ITDFLYKDCR XLXSILAGQP PSPIETSSAS  240
FQGXKDSYPV GSNNKVKSTV SISSSGINST LKRKIREENT KENLFPLINL ESKNKDGNVL  300
LSKKLAAGNV VNCYIPNHLQ NDIPKANPTV PANFEEFNEM GFLATYSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-691117513170NAC domain-containing protein 19
4dul_A1e-691117513170NAC domain-containing protein 19
1ut7_B1e-691117513170NO APICAL MERISTEM PROTEIN
1ut7_A1e-691117513170NO APICAL MERISTEM PROTEIN
1ut4_B1e-691117513170NO APICAL MERISTEM PROTEIN
1ut4_A1e-691117513170NO APICAL MERISTEM PROTEIN
3swp_D2e-691117616174NAC domain-containing protein 19
3swp_C2e-691117616174NAC domain-containing protein 19
3swp_B2e-691117616174NAC domain-containing protein 19
3swp_A2e-691117616174NAC domain-containing protein 19
3swm_D2e-691117616174NAC domain-containing protein 19
3swm_C2e-691117616174NAC domain-containing protein 19
3swm_B2e-691117616174NAC domain-containing protein 19
3swm_A2e-691117616174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008355180.10.0PREDICTED: NAC domain-containing protein 2-like
RefseqXP_008359072.10.0PREDICTED: NAC domain-containing protein 2-like
TrEMBLM5W7331e-168M5W733_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g03080.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.15e-74NAC domain containing protein 25